Sermorelin 10mg

Sermorelin Acetate 10mg

Sermorelin Acetate, a synthetic 29-amino-acid peptide corresponding to the biologically active N-terminal fragment of human growth hormone-releasing hormone (GHRH), supplied as a 10mg lyophilised research material. Laboratory-grade peptide with batch verification, COA access where available and fast UK shipping from Evolve Biolab UK.

Product Overview

Sermorelin is a synthetic, amidated 29-amino-acid peptide corresponding to amino acids 1–29 of naturally occurring human growth hormone-releasing hormone, commonly abbreviated as GHRH or GRF.

Within controlled laboratory models, Sermorelin has been investigated in connection with GHRH receptor interaction, growth hormone signalling pathways, pituitary signalling mechanisms and peptide receptor activity.

Sermorelin Acetate represents the acetate salt form of the peptide and is supplied here as a 10mg lyophilised research material intended exclusively for controlled laboratory research, analytical testing and scientific investigation.

Common Research Areas

• Growth hormone-releasing hormone (GHRH) receptor research
• Peptide-receptor interaction studies
• Pituitary signalling pathway investigation
• Growth hormone signalling models
• GHRH fragment structure-and-activity research
• Peptide stability and characterisation studies
• Analytical identification and purity assessment

Scientific Values

• Compound: Sermorelin Acetate
• Peptide designation: GHRH (1–29)-NH₂
• Peptide length: 29 amino acids
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
• Molecular formula (acetate): C₁₅₁H₂₅₀N₄₄O₄₄S
• Molecular weight (acetate): Approximately 3417.9 g/mol
• CAS: 114466-38-5
• Parent peptide PubChem CID: 16132413
• Research classification: Synthetic peptide research compound
• Peptide class: Growth hormone-releasing hormone fragment
• Research target: Growth hormone-releasing hormone receptor (GHRH-R)

Product Specifications

• Compound: Sermorelin Acetate
• Alternative designation: GHRH (1–29)-NH₂ Acetate
• Appearance: Lyophilised powder
• Format: Single research vial
• Strength available: 10mg
• Purity: Refer to current batch COA
• Storage: Store refrigerated at 2–8°C
• Intended setting: Laboratory research and analytical use

Batch Verification & COA Access

Each vial is designed to support product and batch-level verification on arrival. Customers can scan the printed QR code to access our Advanced COA Verification System, verify authenticity and review batch-specific certificate documentation where available.

For newly released products, COA documentation may still be undergoing processing and will be added to our verification system once available.

Important Information

This product is supplied strictly for laboratory research and analytical purposes only.

Not for human or veterinary use. Not for injection. For research use only.

We do not provide dosage, administration, reconstitution, protocol or personal-use guidance, in line with our policy.

Product images are for illustrative purposes only. Packaging, vial appearance, powder quantity and batch presentation may vary between production batches. Please refer to the laboratory analysis and current batch documentation for product-specific information.